Premiumhealing-recovery

LL-37

LL-37, also known as Cathelicidin, is a cationic peptide composed of 37 amino acids and is primarily found in neutrophils. The peptide appears to be produced by the extracellular breakdown of the hCAP18 proteins caused by protease enzymes. Researched for its potential antimicrobial characteristics, the peptide appears to form agglomerates and lipid bilayers, which may prevent it from easily degrading and protect it from enzymatic action. Antimicrobial peptides are structured with the potential to fight against bacteria, fungi, and some virus strains. These peptides may interact with targets in a non-specific fashion, which supports researchers' belief that once the peptide is introduced, pathogens are unable to develop resistance against these peptides. LL-37 is a α-helical peptide that scientists believe is required to maintain immunity against all microbes. To understand the functioning of the peptide, a peptide model was created as part of a study based on the assumption that the peptide might interact directly with the bacterial membrane. This study suggested that the peptide first interacts with the lipids on the bacterial membrane via electrostatic characteristics, followed by lateral diffusion and consequent assembly of the peptide on the membrane. This potential interaction may lead to membrane interference and degradation of the bacterial cell. Several other studies hypothesize how the peptide interacts with microbial membranes, including pore formation on the membrane and extreme membrane disruption caused by the peptide and lipid complexes. These studies universally suggest that peptides have the potential to interact with the microbial membrane, leading to membrane breakdown.

$105.00 USD/ 5mg

Technical Specifications

Technical specifications for LL-37
Sequence	[LL-37, 37 aa]
Molecular Formula	C205H340N60O53S
Molecular Weight	4525.4 g/mol
Purity	≥95% (HPLC)
Form	Lyophilized powder
Storage	-20°C, desiccated
CAS	154947-66-7
Also Known As	CAP-18

Application Areas

Tendon and ligament healing studies

Muscle injury recovery protocols

Gastrointestinal tissue repair research

Anti-inflammatory pathway research

Wound healing research

Veterinary wound healing applications

COA Verified

Fast Shipping

Secure Payment

For Research Use Only. Products are not for human or veterinary consumption. Not a drug, dietary supplement, or medical device. Sold exclusively to qualified research professionals.

Bio-Engineered Precision

Antimicrobial peptides are structured with the potential to fight against bacteria, fungi, and some virus strains. These peptides may interact with targets in a non-specific fashion, which supports researchers' belief that once the peptide is introduced, pathogens are unable to develop resistance against these peptides. LL-37 is a α-helical peptide that scientists believe is required to maintain immunity against all microbes. To understand the functioning of the peptide, a peptide model was created as part of a study based on the assumption that the peptide might interact directly with the bacterial membrane. This study suggested that the peptide first interacts with the lipids on the bacterial membrane via electrostatic characteristics, followed by lateral diffusion and consequent assembly of the peptide on the membrane. This potential interaction may lead to membrane interference and degradation of the bacterial cell. Several other studies hypothesize how the peptide interacts with microbial membranes, including pore formation on the membrane and extreme membrane disruption caused by the peptide and lipid complexes. These studies universally suggest that peptides have the potential to interact with the microbial membrane, leading to membrane breakdown.

Purity Level≥95% (HPLC)

Molecular Weight4525.4 g/mol

Molecular FormulaC205H340N60O53S

SequenceLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

LL-37 Peptide and Inflammatory Response

The main aim of this study was to determine the inflammatory potential of this peptide. Tissue culture was used, half without alteration and the other half with added U1 RNA.

Proposed Mechanism

U1 RNA is a non-coding RNA released upon tissue injury. LL-37 peptide was then added to both cultures. Upon genetic analysis, it was suggested by the researchers that the culture that was given both U1 RNA and LL-37 peptide stimulated a reportedly significant response towards epidermal inflammation and defense response. The study proposes that the peptide might potentially enhance the immune system's response to damaged cells by influencing how self-nucleic acids (DNA and RNA) are recognized. This recognition is apparently facilitated when the peptide interacts with specific cellular receptors, including scavenger receptors (SRs), which may lead to clathrin-dependent endocytosis. This process appears critical for the subsequent activation of inflammatory pathways within the cells. Moreover, the study indicates that LL-37 might enable the binding of dsRNA (double-stranded RNA) to these scavenger receptors, which in turn might lead to a series of signaling events culminating in cytokine expression.

Signaling Pathway

Notably, the interaction between LL37 and scavenger receptors such as SR-A6 and SR-B1 may be essential for this process, as blocking these receptors with a competitive inhibitor like fucoidan or silencing their expression significantly reduced cytokine production. Another interesting aspect of the study is the hypothesis that LL-37 may modulate the immune system by potentially altering how intracellular signaling pathways, such as those involving Toll-like receptors (TLR) and the interferon regulatory factors, and may be activated in response to foreign nucleic acids. As detailed in the study, the involvement of clathrin-mediated endocytosis suggests that LL-37 may help orchestrate the entry of these immune-modulating molecules into cells, which is a vital step for triggering an immune response.

LL-37 Peptide and Autoimmunity Models

The main aim of this study was to understand the role of LL-37 in models of autoimmunity such as psoriasis. This disease pathogenesis study suggested that endogenous peptide may form complex DNA, increasing interferon mechanisms and more inflammatory responses.

Key Findings

This study theorized that LL-37 may be favorable for tissue and wound injury; however, in some cases, LL-37 levels appeared to indicate psoriasis presence. In fact, it might potentially exert anti-apoptotic actions on keratinocytes, which might be linked to the observed cellular proliferation in psoriatic lesions. LL-37 is a naturally occurring antimicrobial peptide that forms part of the immune system, playing various roles in immune responses. This action may potentially contribute to developing the thick, scaly skin that is a hallmark of psoriasis. While LL-37 has been implicated in promoting inflammation via type I interferon (IFN) pathways, it appears to simultaneously offer a protective action against the activation of the AIM2 inflammasome by cytosolic double-stranded DNA (dsDNA).

Proposed Mechanism

Cytosolic dsDNA often triggers immune responses that may lead to inflammation. In cases where LL-37 forms complexes with DNA, these complexes seemingly do not promote the production of interleukin-1β (IL-1β), a pro-inflammatory cytokine, nor activate the inflammasome. This implies that LL37 might protect keratinocytes from the inflammatory responses typically triggered by the AIM2 inflammasome in the presence of dsDNA. This dual potential of LL-37 underscores its complex involvement in immune regulation and inflammatory processes.

LL-37 Peptide and Arthritis

The main objective of this study was to evaluate the potential of LL-37 in arthritic joints. A group of rats were used in this study, with one control group and one group experimentally induced with rheumatoid arthritis.

Key Findings

Upon inducing the condition, researchers reported an apparent increased regulation of rCRAMP, the rat analog of LL-37 peptide, in inflammatory cells. Researchers suggested that LL-37 peptide might further induce apoptosis of osteoblasts, thereby leading to decreased bone formation in the joints. This study suggested that increased LL-37 levels are characteristic of joint aches and arthritis and may potentially be used for diagnostic purposes. Besides these, study has suggested that LL-37 elevation is seen in other inflammatory circumstances, such as arteriosclerosis.

Key Observations

Scientists report that LL-37 activation and the consequent upregulation of interferons are characteristic of arteriosclerosis-induced cells. The researchers of this study suggested that the peptide may have potential as an immunomodulatory agent.

LL-37 Peptide and Tissue Repair

In this study, mice presented with an anti-inflammatory compound were then presented with LL-37 to study the potential of this peptide on angiogenesis and wound healing. The researchers suggested that the peptide mice exhibited an apparent increase in vascularization and skin cell formation.

Key Findings

This study suggested that LL-37 has the potential to induce endothelial skin cell proliferation and formation of tubule-like structures, which are both required in angiogenesis mechanisms. Further, the study indicates that LL37 possibly counteracts the activation of macrophages triggered by lipopolysaccharide (LPS), a component known to provoke immune responses. Furthermore, it seems to foster endothelial cell behaviors essential for wound healing, such as proliferation, migration, and the formation of tubule-like structures, all indicative of angiogenesis.

Key Observations

Experiments on catabolism-induced murine models, utilizing both synthetic and recombinant forms of LL-37, suggest that exposure to the peptide may enhance vascularization and re-epithelialization. These observations collectively lead to the hypothesis that the peptide might be crucial in promoting wound regeneration, potentially through its actions on vascularization.

LL-37 Peptide and Cancer Cells

Studies are ongoing to explore the potential of the peptide in cancer cell development. These studies have suggested that the peptide may inhibit gastric cancer cell proliferation by activating the bone morphogenetic protein signaling system.

Key Findings

The main aim of this research was to consider the potential of LL-37 as an immunotherapeutic agent or consider the potential of LL-37 peptide as an adjuvant in eliminating cancer cells from the host system. CpG oligodeoxynucleotides are widely considered to be immunotherapeutic compounds as they appear to promote the tumor-suppressing activity.

Key Observations

When presented with LL-37, researchers reported that the peptide LL-37 appeared to increase the CpG oligodeoxynucleotides sensitivity in lymphocytes.

LL-37 Peptide and GI Tract

LL-37 may potentially impact ailments associated with the gastrointestinal (GI) tract. There appears to be an increased expression of LL-37 in research models of gastrointestinal ulcers.

Proposed Mechanism

This upregulation might be mediated through the activation of Toll-like receptor 3 (TLR-3) by its ligand, polyinosinic-polycytidylic acid (poly(I)). Poly(I) stimulation possibly enhances LL-37 expression by triggering intracellular signaling cascades involving proteins such as Toll/IL-1R domain-containing adaptor-inducing interferon (TRIF), tumor necrosis factor receptor-associated factor 6 (TRAF6), and transforming growth factor β-activated kinase 1 (TAK1). Owing to its antimicrobial potential, LL-37 may be capable of protecting GI mucosa from microbial damage.

Key Findings

The protective potential of this peptide in the gastrointestinal tract may involve its interaction with lipopolysaccharide (LPS), a component of bacterial cell walls. LL-37 may be able to suppress LPS-induced secretion of pro-inflammatory cytokines such as interleukin-6 (IL-6) and IL-8 in colonic subepithelial myofibroblasts (SEMFs), which possibly contributes to a protective action by moderating local inflammation.

[1]
Kahlenberg, J Michelle, and Mariana J Kaplan. “Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease.” Journal of immunology (Baltimore, Md. : 1950) vol. 191,10 (2013): 4895-901https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3836506/
[2]
Seil, M., Nagant, C., Dehaye, J. P., Vandenbranden, M., & Lensink, M. F. (2010). Spotlight on Human LL-37, an Immunomodulatory Peptide with Promising Cell-Penetrating Properties. Pharmaceuticals, 3(11), 3435–3460. hhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4034075/
[3]
Zeth, Kornelius, and Enea Sancho-Vaello. “The Human Antimicrobial Peptides Dermcidin and LL-37 Show Novel Distinct Pathways in Membrane Interactions.” Frontiers in chemistry vol. 5 86. 7 Nov. 2017https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5681987/
[4]
Brogden KA. Antimicrobial peptides: pore formers or metabolic inhibitors in bacteria? Nat Rev Microbiol. 2005 Mar;3(3):238-50https://pubmed.ncbi.nlm.nih.gov/15703760/
[5]
Ludtke SJ, He K, Heller WT, Harroun TA, Yang L, Huang HW. Membrane pores induced by magainin. Biochemistry. 1996 Oct 29;35(43):13723-8https://pubmed.ncbi.nlm.nih.gov/8901513/
[6]
Bechinger B, Lohner K. Detergent-like actions of linear amphipathic cationic antimicrobial peptides. Biochim Biophys Acta. 2006 Sep;1758(9):1529-39https://pubmed.ncbi.nlm.nih.gov/16928357/
[7]
Takahashi, T., Kulkarni, N.N., Lee, E.Y. et al. Cathelicidin promotes inflammation by enabling binding of self-RNA to cell surface scavenger receptors. Sci Rep 8, 4032 (2018)https://doi.org/10.1038/s41598-018-22409-3
[8]
Hoffmann MH, Bruns H, Bäckdahl L, Neregård P, Niederreiter B, Herrmann M, Catrina AI, Agerberth B, Holmdahl R. The cathelicidins LL-37 and rCRAMP are associated with pathogenic events of arthritis in humans and rats. Ann Rheum Dis. 2013 Jul;72(7):https://pubmed.ncbi.nlm.nih.gov/23172753/
[9]
Ramos R, Silva JP, Rodrigues AC, Costa R, Guardão L, Schmitt F, Soares R, Vilanova M, Domingues L, Gama M. Wound healing activity of the human antimicrobial peptide LL37. Peptides. 2011 Jul;32(7):1469-76. doi: 10.1016/j.peptides.2011.06.005. Epub 2011 Jun 13https://pubmed.ncbi.nlm.nih.gov/21693141/
[10]
Wu, W. K., Wang, G., Coffelt, S. B., Betancourt, A. M., Lee, C. W., Fan, D., Wu, K., Yu, J., Sung, J. J., & Cho, C. H. (2010). Emerging roles of the host defense peptide LL-37 in human cancer and its potential therapeutic applications. International journal of cancer, 127(8), 1741–1747https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2930073/
[11]
Wang, C., Wang, S., Li, D., Chen, P., Han, S., Zhao, G., Chen, Y., Zhao, J., Xiong, J., Qiu, J., Wei, D. Q., Zhao, J., & Wang, J. (2021). Human Cathelicidin Inhibits SARS-CoV-2 Infection: Killing Two Birds with One Stone. ACS infectious diseases, 7(6), 1545–1554. Kusaka; et al. Expression of human cathelicidin peptide LL-37 in inflammatory bowel disease. Clin Exp Immunol. 2018 Jan;19(11). Epub 2017 Sep 28https://pubmed.ncbi.nlm.nih.gov/28872665/

Certificates & Testing

Batch-level purity documentation

Every P3X Labs batch is independently tested by a third-party laboratory. COA documents confirm purity, identity, and absence of contaminants. Lot-specific COAs are linked to each shipment via QR code on the vial label.

COA: assigned at fulfillment — scan QR on vial

HPLC tested

Mass spectrometry verified

≥99% purity guaranteed